SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006790 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006790
Domain Number 1 Region: 144-280
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.00027
Further Details:      
 
Domain Number 2 Region: 261-355
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000671
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 74-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000257
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 383-479
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000126
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006790   Gene: ENSMPUG00000006844   Transcript: ENSMPUT00000006903
Sequence length 1076
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:25378347:25409071:1 gene:ENSMPUG00000006844 transcript:ENSMPUT00000006903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWHSIRAAVLLIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREG
EDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTP
FFIIYCRALNSLGQDLERPLELRVRVLDINDNPPVFSMSTFVGQIEENSNANTLVMILNA
TDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYSQYSLAVRGSD
RDGGADGMSAECECNIRILDVNDNIPYMEQPSYSTSIEENALHSNLLQIRVIDLDEEYSA
NWVAVIFFISGNEGGWFDIEMNERTNVGILKVIKPLDYEAMQTMQLSLGVRNKAEFHSSI
MSQYKLTATAVTVAVSNVIEGSVFRPGSKTYVVTSNMGQNYKVGDFIATDLDTGSASTTV
RYVMGNNPANLLDVDSKTGIIILRNRVTWEQYKMLGGKYQGTILSIDDNLQRTCTGTINI
DLQGSGWAEKDINSGTNSGTSGGSEGTSGGSEGTSGGSEGTSGGSEGTSGGSGSTGGSST
ENMEGGGETSTEYGTETQTMEGGEGVGANLSDNVHFGPAGIGLLIMGFLVLGLVPFLLMC
CECGGAPGGGAGFEPVPECSEGALHTWAVEGPQLPPDTVCVPPISPPGANLIECIDTSGV
YTNEYGGREMQDLGGGERTTGFELTEGVKTSGVPEICQEYSGTLRRNSMRECREGGLNMN
FMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLG
PKFKKLADISLGKEVEPYPDPDPSWPPEGTEPICPQQGTDPITGGHPPISPHFGATTVIS
ESTYPSGPGVQHPMPIPDPLGYGNVTVTESYTTSGTLKPSVHIHDNRHASNVVVTERVVG
PISGTDLHGMLEMPDLRDGSNIIVTERVIAPSSSLPTSLTMPDPRESSNVVVTERVIRPA
SGMMGNLSIHPELSNTQNVIVTERVVSGSAISGISGPAGMTGGSGLVGSVAGGSGGGIGL
SSLGGGGGLSSSMGGTATIGHMRSSSDHHFSQTLGSASPSTARSRITKYSTVQYTK
Download sequence
Identical sequences M3Y639
ENSMPUP00000006790 ENSMPUP00000006790 XP_004742933.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]