SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006820 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006820
Domain Number 1 Region: 248-465
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.22e-84
Family Fibrinogen C-terminal domain-like 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006820   Gene: ENSMPUG00000006875   Transcript: ENSMPUT00000006934
Sequence length 467
Comment pep:novel scaffold:MusPutFur1.0:GL896921.1:3193608:3201089:1 gene:ENSMPUG00000006875 transcript:ENSMPUT00000006934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPPLRTLQLLLLLGATWARAGAPRCTYTFVLPQQKFTGAVCWSGPSTARPAAEAVNAS
EVAALRMRVGRHEELLRELQRLAAADGAVAGEVRALRKESRGLSARLGQLRAQLQHEAGP
GAGPGPGAEPAAPLALLGERVLNVSAEAQRAAARFHQLDVKFRELAQLVTQQSGLIARLE
RLCPGGTGGQQQVLPPPLVPVVPVSLVGGTNDTSRRLDPAPEPQRDQTLRQQGPLASPMP
AGHPAVPTKPTGPWQDCAEAHQAGHRQSGVYELRLGRHVVSVWCEQQLEGGGWTVIQRRQ
DGSVNFFTTWQHYKVGFGQPDGEYWLGLEPVHQLTSRGDHELLVLLEDWGGRGARARYDG
FSLEPESDHYRLRLGQYYGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHAC
AHSNLNGVWHRGGHYRSRYQDGVYWAEFRGGAYSLKKAAMLIRPLRL
Download sequence
Identical sequences M3Y669
ENSMPUP00000006820 ENSMPUP00000006820 XP_004748533.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]