SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006836 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006836
Domain Number 1 Region: 508-569
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000163
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006836   Gene: ENSMPUG00000006891   Transcript: ENSMPUT00000006950
Sequence length 575
Comment pep:novel scaffold:MusPutFur1.0:GL896900.1:18364987:18536814:1 gene:ENSMPUG00000006891 transcript:ENSMPUT00000006950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPVDQGPASGRVRALEEQLLKAKEQIENYKKQTRNGLGKDHEILRRRIE
NGAKELWFFLQSELKKLKNLEGSVLQRHADEFLSDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGTSTGHWSGEVKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKRRVYLATDDPSLLKEAKTK
YPTYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYPHQPRTADEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
Download sequence
Identical sequences M3Y685
ENSMPUP00000006836 XP_004739002.1.14098 XP_004739003.1.14098 XP_004739005.1.14098 XP_004739006.1.14098 XP_004739007.1.14098 XP_004739008.1.14098 XP_012912556.1.14098 XP_012912567.1.14098 XP_012912577.1.14098 XP_012912580.1.14098 XP_012912593.1.14098 ENSMPUP00000006836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]