SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006880 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006880
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-16
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 210-322
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000017
Family Cadherin 0.005
Further Details:      
 
Domain Number 3 Region: 87-182
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000124
Family Cadherin 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006880
Domain Number - Region: 328-416
Classification Level Classification E-value
Superfamily Cadherin-like 0.00016
Family Cadherin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006880   Gene: ENSMPUG00000006935   Transcript: ENSMPUT00000006994
Sequence length 936
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:25566702:25587897:1 gene:ENSMPUG00000006935 transcript:ENSMPUT00000006994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKISATDADEPNTLNSKISYRIVSQEPAYPPVFYLNKDTGEIYTTSFTLDREEHSSYTLT
VEARDGNGQITDKPVNQAQVQIRILDVNDNIPIVQNEMAEKVEIEENQANVVVMRIKVFD
ADEIGSDNWLANYTFVSGNEMGYFHIETDTQTNEGIVTLIKEVDYEEIKNLDFSITVTNK
AAFHKSVKNKYKPTSFPFKVNVKNVKEGIHFRSSTISVHVSESMDKSSQGQIIGKFQAFD
EDTGQVAHVRYVKLEDRDNWISVNSATSEIKLVKIPDFESRYVQNGTYTAKILAISESYP
RKTITGTIAITVEDINDHCPTLVDPVQTVCDNVPYVNVTAEDLDGSQNSGPFSFSIIDKL
AGMAEEWQIVHQESTSVLLQHKELKPGRREIQFLISDSQGLSCPEKQVLKLTICKCLEGG
GCVEPLQDSYVGLGPAAIALIILALLLLLLVPLLLLMCQSGEGAKGFTPIPATIEMLHPW
NNEGAPPEDKVVPLHVAADHGVGVGTDMTVGGAMTKETPKESGSAFLKGHHEVTEVDGRW
EEPRSLISGQVTEGIGTTGANIGADGTRVMKATGSSRDLVGARAAAVPVNEEFLRSYFTE
KAASYTDEDDIHAGKDCLLVYSQEDTESLHGSIGCCSFIEGELDDRFLDDLGFKFRTLAE
ICLGQKIDMDGEIEPRQKPVGASSMTATSHSFSEQTRINSENAYFTGSSFQVPKPLPEAN
TEKVTQEIVTKSSQSSRQSQKVATRLPDPLASGNVVVTETSYAAGSTMPPSTAILGPGQA
QALIVTERVYAPAPPSVERQYGNDGSVVVTERIIQPNGGLPGSLEGSQPLPDAHYVMVRE
RERFLAPSLGLPSPLAVSAAAAGGNVTVTERVQTSASGYRFPTETSQMARKTEVSGAAVR
GPLPNFSLEESGHLTSTRTTPSTRVSKHSIVQHSYS
Download sequence
Identical sequences M3Y6C9
ENSMPUP00000006880 ENSMPUP00000006880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]