SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006937 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006937
Domain Number 1 Region: 69-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-52
Family Astacin 0.00012
Further Details:      
 
Domain Number 2 Region: 428-591
Classification Level Classification E-value
Superfamily TRAF domain-like 6.54e-36
Family MATH domain 0.0012
Further Details:      
 
Domain Number 3 Region: 266-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-28
Family MAM domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006937
Domain Number - Region: 638-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00173
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006937   Gene: ENSMPUG00000006993   Transcript: ENSMPUT00000007052
Sequence length 733
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:26128118:26147529:1 gene:ENSMPUG00000006993 transcript:ENSMPUT00000007052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWYLPCFLLSAALLMVPGLPTQDNFVKDVDGGLDQDIFDINEDLGLDLFEGDIRLDGA
QDRNSIIGEEYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGEANYISV
FKGSGCWSSVGNRHMGKQQLSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWD
RIQSGKEHNFNTYDDQISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFMDVIGQR
MDFSDSDLLKLNQLYNCTTSLSFMDSCNFELENVCGMIQSSDDNADWQWVSQVPRGPESD
HSSMGQCKGSGFFMHFNSSSVSVGATAMLESRILYPKRGFQCLQFYLYNSGSENDQLNIY
TREYSADHVTGTLTLVKEIKEIPLGSWQLHHVTLKVTNKFRVVFGGVRGAGASLGGLSLD
DINLSETQCPHHIWHIKNFTQFIGNSSGTLYSPPFYSSKGYAFQIYLNLNHSTNAGIYFH
LISGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSVTTDPSMTTDNGNYFWDRPSK
VGAVAFFPNGTQFRRGPGYGTSAFITHNRLKSRDFIKGDDVYILLTVEDISHLNSTQVQP
SSPSPPNQSSPPSPSSPSSPPSPPTPPSLPSPTSVINDLCMNFKCENDGICIVQNGKAEC
RCLSGEDWWYLGKRCEKRGSTRDTIVIAASSTVAMFALMLIVTLVTVYCMRKKYRRRTSS
NTADLSLENVSRV
Download sequence
Identical sequences M3Y6I6
ENSMPUP00000006937 ENSMPUP00000006937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]