SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006952 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006952
Domain Number 1 Region: 19-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-76
Family FCH domain 0.00000000014
Further Details:      
 
Domain Number 2 Region: 454-465,506-562
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000063
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006952
Domain Number - Region: 359-428
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000654
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006952   Gene: ENSMPUG00000007008   Transcript: ENSMPUT00000007067
Sequence length 565
Comment pep:known scaffold:MusPutFur1.0:GL897062.1:2667968:2701734:1 gene:ENSMPUG00000007008 transcript:ENSMPUT00000007067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWTERRRRAAGXFGGSSMDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAY
AKQLRSLVKKYLPKRPSKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLEL
AKYSQEMKQERKMHFQEGRRAQQQLESGFKQLENSKRKFERDCREAEKAAQTAERLDQDI
NATKADVEKAKQQAHLRSHMAEESKNEYAAQLQRFNRDQSHFYFSQMPQIFDKLQDMDER
RAAHLGAGYGLLSEAELQVVPIIAKCLEGMKVAADAVDAKNDSQVLIELHKSGFARPGDV
EFEDFSQPMNRVPSDSSLGTPSDGRPELRGSGRSRAKRWPFGKRNKTVVTEDFSHLPPEQ
QRKRLQQQLEERNRELQKEVDQREALKKMKDVYEKTPQMGDPASLEPRITETLNNIERLK
LEVQKYEAWLAEAESRVLSNRGDSLGRHTRPPDPPASVPPDSSSSNNSGSQDPKESSEEP
LSEEGQDAPIYTEFDEDFEEESASPIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGD
GWTRVRRKQGGEGYVPTSYLRVTLN
Download sequence
Identical sequences M3Y6K1
ENSMPUP00000006952 ENSMPUP00000006952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]