SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006966 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006966
Domain Number 1 Region: 337-397
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000267
Family PHD domain 0.0073
Further Details:      
 
Domain Number 2 Region: 282-346
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000031
Family PHD domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006966
Domain Number - Region: 99-177
Classification Level Classification E-value
Superfamily Major capsid protein VP5 0.0471
Family Major capsid protein VP5 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006966   Gene: ENSMPUG00000007022   Transcript: ENSMPUT00000007081
Sequence length 410
Comment pep:novel scaffold:MusPutFur1.0:GL897047.1:5134890:5151373:-1 gene:ENSMPUG00000007022 transcript:ENSMPUT00000007081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVID
LMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQLQQQNTQKVEASKVPEYIKKAAKKAA
EFNSNLNRERMEERRAYFDLQTHVIQVPQGKYRVLPTERTKVSSYPVALIPGQFQEYYKR
YSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDAEDGRGDEKQKHKGTSDSSSGNVSE
GEGLPDGQEEPFQGRQRSKDKAATPRKDASKRSVLSKSVPGYKPKVIPNALCGICLKGKE
SNKKGKAESLIHCSQCDNSGHPSCLDMTMELVSMIKTYPWQCMECKTCIVCGQPHHEEEM
MFCDVCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Download sequence
Identical sequences M3Y6L5
ENSMPUP00000006966 XP_012899834.1.14098 ENSMPUP00000006966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]