SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006969 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006969
Domain Number 1 Region: 734-980
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-63
Family Nuclear receptor ligand-binding domain 0.0000000596
Further Details:      
 
Domain Number 2 Region: 600-678
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-27
Family Nuclear receptor 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006969   Gene: ENSMPUG00000007025   Transcript: ENSMPUT00000007084
Sequence length 982
Comment pep:known scaffold:MusPutFur1.0:GL896960.1:3758050:4098268:-1 gene:ENSMPUG00000007025 transcript:ENSMPUT00000007084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHSLPEGLDMERRWGQVSQAVEHSSLGPPERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPCLQQDNNRSGILTSDIKTELESKELSATVAESMGLYMDSVRDADYTYD
QQNQQGSMSPAKIYQNVEQLVKFYKENGHHSSTLGSVNRPLRSFMPDSGSSVNGGVMRAI
VRSPILCHEKSPSVCSPLNMTSSVCSPAGISSVSSTSASFGSFAVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPTASTMGSTCSPVNNAFSYAASGAPAGSSAARDVAP
SPDTQEKGAQEGPFPKSEEVENAISNGVAGQLSIVQYIKPEPDGAFSSSCLGGNSKINSD
SPFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPMGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVTSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQSQQQQPPPPPPQSPEEGTTYIPPAKEPSVNTA
LVPQLSTISRALTPSPVMILENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVK
WAKVLPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQ
SAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKE
LRKMVTKCPSNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVE
IISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences M3Y6L8
XP_004758088.1.14098 ENSMPUP00000006969 ENSMPUP00000006969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]