SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006997 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006997
Domain Number 1 Region: 344-411
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.17e-24
Family PHD domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006997
Domain Number - Region: 33-80
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.00235
Family Staphylocoagulase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006997   Gene: ENSMPUG00000007054   Transcript: ENSMPUT00000007113
Sequence length 418
Comment pep:known scaffold:MusPutFur1.0:GL896904.1:17386645:17415041:-1 gene:ENSMPUG00000007054 transcript:ENSMPUT00000007113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHATTDHIPEKKFKSEALLSTLTSDAS
KENTLGCRNNNSTASSNNAYNVNSSQPLASYNVGSLSSGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMPRETAGYSSSSALMTTLTQNTSSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK
Download sequence
Identical sequences M3Y6P6
ENSMPUP00000006997 ENSMPUP00000006997 XP_004741951.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]