SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007001 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007001
Domain Number 1 Region: 1154-1374
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1364-1522
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-20
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 1507-1572
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-16
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007001   Gene: ENSMPUG00000007058   Transcript: ENSMPUT00000007117
Sequence length 1595
Comment pep:novel scaffold:MusPutFur1.0:GL897067.1:756314:772308:1 gene:ENSMPUG00000007058 transcript:ENSMPUT00000007117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEPQHGVSTPIPALAELSVTPEALRRSRQTAALGPEAQEGWEPSSAWAEGRGLSETQ
RGASRDVKSCATKSVTSFPKEAPAGAETTQEDSVGEMGDTPELQELVPHSPTGGGARTPA
PSQLGACLVQGEHLDMAPGSGELGGGVEMEFRLEPTSSTGETGHAEEKGAFPDASAQPRF
GPSCEQCPEETHQPGDSVRHGEEPQLTAAREGPGSGGPECLLAAEGLGEQGPADAGFQEE
AAVGEGGRSGEQEQKGEQGDRTKGEQRPKQQQRQGDPMPARQGERTGLCGDSEGLHCPEQ
EMKTQGWGDPPQGEEGKREFGGPQESSVDAQNEERQSLVGRSGKGTGRQEGQGLQRKVMF
AQRQEEEPGNWDGDPLRREAGERSTEEGEARDGPSTQAPVASEVSSPCDLFLDTCHPKTS
VPGTPREPRAEEPLPVAPAPARESGQWSSQPVSLPGSFPAGESPDQEIALDSQQEGSELG
KGAVFTQGTELVSAGTSAAPPRTPGSAPCSPADVSPSTATPSSASPPVASSRRESSLAAH
SSETSRASVWTNNTSHAEASGTPPAPLRGFLTTEATVEISTSSSQANPPSPLGHSTGAFQ
HLRSNSFPGSHRTEPTPDLLGLSLSFSHSELPQEASKPAIYGSVIPRRDRKSGRDGRIIP
ESPSSLSALGQDSQEFTSDPERSGSPCSTQPCGSRHTSASAPESIACGSSPPLVSVDARI
HEPLPPPPPEKRRVHPSMVERDSHLHAGVPMLKRCGQPLPLAPGSGLHGPPKGPLPPVPD
SLVARQHRPLPSTPDTPHPTQTSPSHRLRYNKPLPPTPDFSQTHHSVPSSSSPRTYRPLP
PVPIVDPPTEPPPLPPKSRGRSRSTQGELMNAGGQGKPRPICPERTVATPHSVGRTSWPP
AMGRSTDSSAPTSRSKSEGAPGMAFSNVATLLSPSSPTTPWSLELPGPTSEPGPSEESGA
PGRGSLRRTAPQEGANGLRRLDVGQARQPAKLSHPHLEKASSWPHRRDPGRPPASSSGQV
VDPGEGSSRHKGWNRQGLRRPSILPEGCSDTRGPAVEKVLGPSDTIVFREKKPKEVMGGF
SRRRSKLINSSQLLYQEYSDVVLNKEIQSQQRLDSLGEATGPASPRQPRRTLVSSESYLQ
RLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEAKFELIVSEASYLRSLHVAVDHFQL
SAPLRATLSNQEYQWLFSRLQDVRDVSTMFLSDLEENFERNIFTFQVCDVVLNHAPGFRR
VYLPYVTNQTYQERTFQGLLTSNSSFREVLEKLESDPVCQRLSLKSFLILPFQRITRLKL
LLQNILKRTQPGSSEEAEATKAHHALEELIRDCNNNVQRMRRTEELIYLSQKIEFECKIF
PLISQSRWLVKSGELTALEFSLSPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVFDH
APFSSIRGEKCEMKLHGPHKNLFRLFLLHNAQGTQAEFLFSTETQSEKLRWISALAMPRE
ELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGMRLSDGERGWFP
VQQVEFISNPDVRARNLKEAHRVKTAKLQLVEQRT
Download sequence
Identical sequences M3Y6Q0
XP_004772138.1.14098 ENSMPUP00000007001 ENSMPUP00000007001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]