SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007008 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007008
Domain Number 1 Region: 187-303
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.35e-42
Family eIF-2-alpha, C-terminal domain 0.000000614
Further Details:      
 
Domain Number 2 Region: 90-183
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 4.97e-33
Family eIF2alpha middle domain-like 0.00000207
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.43e-17
Family Cold shock DNA-binding domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007008   Gene: ENSMPUG00000007065   Transcript: ENSMPUT00000007124
Sequence length 315
Comment pep:novel scaffold:MusPutFur1.0:GL896900.1:19952989:19964830:1 gene:ENSMPUG00000007065 transcript:ENSMPUT00000007124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDERGVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
Download sequence
Identical sequences D2HRG8 M3WYU5 M3Y6Q7
ENSMPUP00000007008 XP_004397635.1.74151 XP_004397636.1.74151 XP_004739032.1.14098 XP_006738672.1.47382 XP_007095234.1.5354 XP_008698810.1.72690 XP_011230440.1.58354 XP_011281592.1.62641 XP_014923902.1.86478 XP_017522390.1.32401 XP_019307046.1.44245 XP_021535405.1.83697 ENSMPUP00000007008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]