SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007061 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000007061
Domain Number - Region: 142-179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000471
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number - Region: 37-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000789
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007061   Gene: ENSMPUG00000007118   Transcript: ENSMPUT00000007179
Sequence length 353
Comment pep:novel scaffold:MusPutFur1.0:GL897008.1:1803688:1810323:1 gene:ENSMPUG00000007118 transcript:ENSMPUT00000007179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLATPWLLLSLAIPALDFHMTFSCPNENQCQKALLSDNDIFLPCNSSGAQWYFFFLQDKA
SWPNKVSRVSNIEIIPGTGILIRDPAPSQTGFYHCQDRNGIQVVQYEIDFQDVSTLHITH
RGLGQKPLQNETLSLGGTELIFTHWEPWQDCNRCGEPGERKRLGYCYIKEPLQEPMPCWL
YLGDLKMWSSRMRPEMQVEACQVPCKISTVDFITFDNYEIREDLGPILWEVNDIPLTWQG
QLSNQVLSSILEPTNGGRQLQIFQPAIYKCFVKQELMARFNPRPFPDVPETLQQEETGPQ
LESREARKGKARSVLKGLKLMLLVGIFLGLLGLLLKLCHPSQHKRSDQVLLVK
Download sequence
Identical sequences M3Y6W0
ENSMPUP00000007061 ENSMPUP00000007061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]