SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007095 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007095
Domain Number 1 Region: 108-215
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-17
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 336-468
Classification Level Classification E-value
Superfamily Cadherin-like 2e-16
Family Cadherin 0.00094
Further Details:      
 
Domain Number 3 Region: 219-343
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000003
Family Cadherin 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007095
Domain Number - Region: 448-513
Classification Level Classification E-value
Superfamily Cadherin-like 0.000583
Family Cadherin 0.012
Further Details:      
 
Domain Number - Region: 37-114
Classification Level Classification E-value
Superfamily Cadherin-like 0.00971
Family Cadherin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007095   Gene: ENSMPUG00000007152   Transcript: ENSMPUT00000007213
Sequence length 733
Comment pep:novel scaffold:MusPutFur1.0:GL896972.1:5834076:5863003:1 gene:ENSMPUG00000007152 transcript:ENSMPUT00000007213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKRRRIITTLELDEEDQGPFPKLVAELFNDMSYIMSLMYLISGPGVDAHPEIGLFSIEDH
RNRRVYVHRPVDRRPRCLSSVYFDVVDHLTGKLLDNSLVFNIRIRDVNDHAAQFPEKEFN
ISVKENHMAGQPTFKMLTVDSDEENTPNPQVLYFLISETPSLKESSFQTDPTGREMQLSG
CWKNETAPRFTLLVGAKDSGEPPLTSTATVHVNVQEGSNHRPTFTRENYRIRISEGRTSP
SVLRPPVRDGDLLFTSAWRGRCHILNGNEEGHFDIMTDPEIKEGILNVIKPLDYETRPAR
SLVIAVENEELLFPREGAGSGGPGWGVAASTTVSMQVTDANDPPAFHPRSFVIGEVDGAG
PGIQRGVFNAADPDRAAGPLHVFPSYDPASWVTVDELSGTVTTAQQIDRESPYVNHSFYT
IIVQAVDDGLPPQTGTGTQMLFLSAVSDNGPALHPRSRYVEVCESALSETLLLQAEEADL
EPYADPFTFELDNSWERAGDTWKLGENRGTRLTSVQSRGAREGLSPSLLSRQAGTFQKPT
VHARVCSCPGRGTYVEPSVVVTGTGLLMGALAPACAALMMLAATLLYLLRCCFVSEVRSG
SSEDGQQTLITYNDESKPISTLTGRDMLFEPRGVSNNLAPNPLPHIVVNRLLKYQENLDF
CQGTVSNAFLQKLRGLDALAGDTGDAPHIYEEQGECEGAESLSSLAFSEPDWDPWASQAA
ARKETHSESGGPS
Download sequence
Identical sequences M3Y6Z2
ENSMPUP00000007095 ENSMPUP00000007095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]