SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007123 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007123
Domain Number 1 Region: 236-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-57
Family Reprolysin-like 0.00033
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 888-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 4 Region: 825-884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000129
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 939-1002
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1002-1054
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000127
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007123   Gene: ENSMPUG00000007181   Transcript: ENSMPUT00000007242
Sequence length 1103
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:3070832:3086390:1 gene:ENSMPUG00000007181 transcript:ENSMPUT00000007242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAYQILRWALTLGLGLTFEVIHAFQSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPT
PRRQRRGTGPAPESRLYYKVAAPSTHFLLNLTRSPRLLAGHVSVEYWTREGLAWQRAARP
HCLYAGHLQGQAGSSHVAISTCGGLHGLIVADEEEYLIEPLKGGPKGAQGPEDSGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGNIVNILVTRLILLTEDQPT
LEITHHAGKSLDSFCKWQKSIVNRSGHGNAIPENGVANHDTAVLITRYDICIYRNKPCGT
LGLAPVGGMCERERSCSINEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDD
CPPGSQDFREMQCSEFDSIPFRGKFYTWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPAAG
YEEVVWIPKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLPLAGTTFQLRQ
GPDQTQSLEGLGPINTSLIVMVLARTELAALRYRFNAPIARDALPPYSWHYAPWTKCSAQ
CAGGSQVQAVECRNQLDSSAVAPHHCSAHSKLPKRQRACNTEPCPPDWVVGNWSRCSRSC
DAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACQGPACPPEWAALDWSECTPSC
GPGLRHRVVLCKSSDHRATLPPAHCPPAAKPPATMRCNLRRCPPARWVTGEWSECSAQCG
IGQQQRAVRCSSHTGQPSRECAETLRPPSTQQCEAKCESAPPGDGPEECKDVNKVAYCPL
VLKFQFCSRAYFRQMCCKTCHGR
Download sequence
Identical sequences M3Y719
ENSMPUP00000007123 ENSMPUP00000007123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]