SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007139 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007139
Domain Number 1 Region: 249-336,542-579
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.41e-45
Family Inhibitor of apoptosis (IAP) repeat 0.00000647
Further Details:      
 
Domain Number 2 Region: 22-100
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.44e-29
Family Inhibitor of apoptosis (IAP) repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 165-240
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.75e-29
Family Inhibitor of apoptosis (IAP) repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 441-536
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-19
Family Caspase recruitment domain, CARD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007139   Gene: ENSMPUG00000007197   Transcript: ENSMPUT00000007258
Sequence length 604
Comment pep:novel scaffold:MusPutFur1.0:GL897004.1:6441648:6454791:-1 gene:ENSMPUG00000007197 transcript:ENSMPUT00000007258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVQESLCLSGLLKSAPALELRYDHSCELYRMSTFSTFPAGVPVSERSLARAGFYYTGV
NDKVRCFCCGLMLDNWKLGDRPVEKHRKLYPSCAFVRSLSTASEPGARCPPRQPPSATSS
THPLLPSLETTGYFSGSYASFPSSPVNFRENREFAPRRPSPCEGALKTAEDRLLTFQTWP
LTSPPAQDLARAGFYYVGPGDRVACFACDGKLSNWEPNDSALSEHLRHFPDCPFVDRQLE
DALQSTVSNASMRAHAARLQTFCSWPSRVPVRPEQLATAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIHIKGQEFISRIQASYPHLLEQLLSTSDNTEDENAESP
IVHFGPGEIRSEDAVMMNTPVVAAALEMGFGRSLVRQTVQRKILSTGENYRTVNELVSDL
LHAEDELREEEKERAAENRDSDDAALIRKNRTVLLQRLTHVLPILDSLLAAGVISEHERG
VLEQKARTPLQAGELLDTVLGRGSSAATVFKNSLQEMDPVLYKRIFVQQDLKYIPPENVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRRCPICRGAVKGTVR
TFLS
Download sequence
Identical sequences M3Y735
XP_004764520.1.14098 ENSMPUP00000007139 ENSMPUP00000007139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]