SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007143 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007143
Domain Number 1 Region: 186-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-17
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 2 Region: 398-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 139-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 34-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000131
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007143
Domain Number - Region: 329-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000144
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 355-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000982
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007143   Gene: ENSMPUG00000007201   Transcript: ENSMPUT00000007262
Sequence length 713
Comment pep:novel scaffold:MusPutFur1.0:GL896946.1:7535403:7540058:-1 gene:ENSMPUG00000007201 transcript:ENSMPUT00000007262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTTLLFLLLGGALAHPDRIIFPNPACEDPPAVLLEVQGTLQRPLGRDSRSAPANCTWL
ILGSREQTVTVRFQKLHLACGSERLVLRSPLQPQISLCEAPASPLQLPGGNVTITYSYAG
ARAPLGQGFLLSYSQDWLMCLPEEFQCLNHRCVPLAHRCDSIDACGDGSDEAGCSSDPFP
DLTPAPIPTPPCNHTLEDFYGVFSSPGYTHLASVFHPQSCLWLLDPHDGRRLAVRFTALD
LGYGDAVHVYDGPGPPKTSRLLRSLTHFSNGKAVTVETLSGQAIVAYHTVAWSNGRGFNA
TYHVRGYCLPWDRPCGLGASLGASEGLGERCYSDAQRCDGSWDCADGTDEENCPSCPPGH
FPCGAPGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGG
ASGARRRQRGRSVRRLVRRLRRWGLLPRANPPARSPETRSQVTPSSAPLESPDGNTGPAR
EGGAVGGQDGEQAPPLPVKAPLPPTSASPAPTNVSEAPGPLPSIPLEPSLLSGVVQALRG
RLLPSFRPPGPPRTPPEPHTTVLSPEDEDDVLLLPLAEPGVWVVEAEDEPLLV
Download sequence
Identical sequences M3Y739
ENSMPUP00000007143 ENSMPUP00000007143 XP_012913108.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]