SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007149 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007149
Domain Number 1 Region: 5-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-257
Family Motor proteins 0.0000000000221
Further Details:      
 
Domain Number 2 Region: 1034-1097
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-22
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007149   Gene: ENSMPUG00000007207   Transcript: ENSMPUT00000007268
Sequence length 1097
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:3087795:3121939:1 gene:ENSMPUG00000007207 transcript:ENSMPUT00000007268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIVGNLRKRFMDDYIFTYIGSVLISVNPF
KQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAA
KYIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGG
EPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLQSDT
YKVDGTDDRSDFNETLNAMQVIGIPPNVQQLVLQLVAGILHLGNISFCEDGNYARVESVD
LLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESIDVTLNVEQAAYTRDALAKGLYARL
FDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKA
EQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQ
KLQAAVGTHEHFNSWSSGFVIHHYAGKVSYDVNGFCERNRDVLFSDLIELMQTSEQAFLR
MLFPEKLDVDKKGRPSTAGSKIKKQANDLVGTLKRCTPHYIRCIKPNETKKPRDWEEGRV
KHQVEYLGLKENIRVRRAGFAYRRQFSKFLQRYAILTPETWPQWRGDERQGVQHLLRAVN
MEPDQYQMGSTKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRRHVAVRKYEEMREEAS
NILLNKKERRRNSINRNFVGDYLGLEERPELRQFLAKRERVDFADSVTKYDRRFKPIKRD
LILTPKCVYIIGREKVKKGPEKGQVREVLKKKLEIQALRGVSLSTRQDDFFILQEDAADS
FLETVFKTEFVSLLSKRFEEAARRALPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGSGDL
AILKASGRTLTVSVGDGLPKSSKPTRKGMAQGRPRRSAQAPTRAAPGPPRGLGHNGVPPA
ARSRPLPVEITSGRGSQQPFRGPPSSALRASRRPRARPPSEHNTEFLNVPDQGVAGMQRK
RSVGQRPEPGVGRPKPQPRMHGPRCRALYQYVGQDVDELSFNVNEVIEILMEDASGWWKG
RLHGQEGLFPGNYVEKI
Download sequence
Identical sequences M3Y745
ENSMPUP00000007149 ENSMPUP00000007149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]