SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007164 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007164
Domain Number 1 Region: 391-468
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.73e-23
Family Intermediate filament protein, coiled coil region 0.0004
Further Details:      
 
Domain Number 2 Region: 161-195
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000889
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 3 Region: 197-269
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000785
Family Intermediate filament protein, coiled coil region 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007164
Domain Number - Region: 279-392
Classification Level Classification E-value
Superfamily Prefoldin 0.00314
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007164   Gene: ENSMPUG00000007222   Transcript: ENSMPUT00000007283
Sequence length 594
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2525699:2533963:1 gene:ENSMPUG00000007222 transcript:ENSMPUT00000007283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCRSYRVSSGCRMGNFSSCSAVSPQNLNRFRASSVSCRSGPRFQGLGSFGSRSVIAFGS
CSPRIAAVGPRPIHCGVGFGAGSGMGFGFSDGSSAGLGFGSNSCVGLGFGAGSGLGYGFG
YRVGGFGVPAAPSITAVTVNQSLLTPLNLEIDPNAQRVKKDEKEQIKTLNNKFASFIDKV
RFLEQQNKLLETKWNFLQEQKCAQSNLEPLFENYITNLRRQLDLANSDRARFEAERNHMQ
DVLEGFKKKYEEEVGFRASAENEFVALKKDVDTAFLNKSDLETNVDTLTQEIDFLKTLYM
AEIQLLQSHISETSVIVKMDNSRDLNVDGIIDEIKAQYEEVARRSRADAEAWYQTKYEEM
RVTAGQHCDNLRNTRNEINELTRLIQRLKAEIEHAKAQRAKLEAAVAEAEQQGEAALNDA
KCKLADLEGALQQAKQDMARQLREYQELMNIKLALDIEIATYRRLLEGEEIRICEGVGPV
NISVSSSRGGIVCGPEPLVASSTLSRCGVTFSGSSGIQPSGTCSSSLGGARVIKASGDLL
SAGSRGGSVLMGEAPSTPCPLPTEGNFSSCSGGRSSRSSSVRFMSTTTSHRTKY
Download sequence
Identical sequences M3Y760
XP_004774744.1.14098 ENSMPUP00000007164 ENSMPUP00000007164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]