SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007175 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007175
Domain Number 1 Region: 73-214
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-31
Family Cadherin 0.00000642
Further Details:      
 
Domain Number 2 Region: 304-431
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-26
Family Cadherin 0.00069
Further Details:      
 
Domain Number 3 Region: 193-308
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.00024
Further Details:      
 
Domain Number 4 Region: 6-85
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.00041
Further Details:      
 
Domain Number 5 Region: 417-524
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000771
Family Cadherin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007175   Gene: ENSMPUG00000007233   Transcript: ENSMPUT00000007294
Sequence length 724
Comment pep:novel scaffold:MusPutFur1.0:GL896972.1:7115831:7265487:1 gene:ENSMPUG00000007233 transcript:ENSMPUT00000007294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRMYVTRPMDREERASYHLRAHAVDM
NGNKVENPIDLYIYVIDMNDNRPEFINQVYNGSVDEGSKPGTYVMTVTANDADDSTTANG
MVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYTVIVQATDMEGNLNYGL
SNTATAIITVTDVNDNPPEFTASTYAGEVPENQVEVVVANLTVMDRDQPHSPNWNAFYRI
ISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPLAGGVQMSFQSTA
GVTISVMDINEAPYFPSNHKLIRLEEGVPAGTVLTTFSAADPDRFMQQAVRYSKLSDPAN
WLHINTTNGQITTAAVLDRESLYIKNNVYEATFLAADNGIPPASGTGTLQIYLIDINDNA
PELLPKEAQICEKPSLNAINITAADADVDPNISPYVFELPFVPAAVRKNWTITRLNGDYA
QLSLRVLYLEAGVYDVPIIVTDSGNPPLSNTSIIKVKVCPCDENGDCTTIGAVAAAGLGT
SAIVAILICIVILLTMVLLFVVWMKRREKERHTKQLLIDPEDDVRDNILKYDEEGGGEED
QDYDLSQLQQPESMEHVLSKAPGVRRVDERPVGAEPQYPVRPVVPHPGDIGDFINEGLRA
ADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNQWGPRFKKLADMYGG
GEDD
Download sequence
Identical sequences M3Y769
ENSMPUP00000007175 ENSMPUP00000007175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]