SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007208 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007208
Domain Number 1 Region: 352-429
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.42e-22
Family Intermediate filament protein, coiled coil region 0.0007
Further Details:      
 
Domain Number 2 Region: 122-156
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000298
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007208
Domain Number - Region: 159-230
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00141
Family Intermediate filament protein, coiled coil region 0.0083
Further Details:      
 
Domain Number - Region: 252-353
Classification Level Classification E-value
Superfamily Prefoldin 0.00366
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007208   Gene: ENSMPUG00000007265   Transcript: ENSMPUT00000007327
Sequence length 507
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2549057:2555798:1 gene:ENSMPUG00000007265 transcript:ENSMPUT00000007327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCRSYRISSGCGVTRTFSSCSAVAPKTGNRCCISAAPYRGVSCYRGLTGFGSRSLSNLG
SCGPRMAMGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVK
HEEKEQIKCLNNRFAAFIDKVRFLEQQNKLLETKWQFYQNQRCCESNMEPLFNGYIETLR
REAECVEADSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVVLKKDVDCAYLRKS
DLEANVEALVEESSFLKRLYDEELQVLHAHISDTSVIVKMDNSRDLNMDCVVAEIKAQYD
DIASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEIENAKCQR
AKLEAAVAEAEQQGEAALTDARCKLAELEAALQKAKQDMACLLKEYQEVMNSKLGLDIEI
ATYRRLLEGEEHRLCEGVGSVNVCVSSSRGGVACGGLTCSTTPGRQIASGPVATGGSITV
MAPDSCAPCQPRSSSFSCGSSRSVRFA
Download sequence
Identical sequences M3Y7A1
ENSMPUP00000007208 ENSMPUP00000007208 XP_004774745.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]