SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007218 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007218
Domain Number 1 Region: 544-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000012
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 92-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000874
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 40-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007218
Domain Number - Region: 497-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007218   Gene: ENSMPUG00000007275   Transcript: ENSMPUT00000007337
Sequence length 589
Comment pep:novel scaffold:MusPutFur1.0:GL896928.1:8395318:8461913:1 gene:ENSMPUG00000007275 transcript:ENSMPUT00000007337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAAAFFILSLMTCQPGVTIQEKVNRRVSRAVQNSSPRAVSCQLSHWSEWTDCLPCQDKK
YRHRSLLQPNKFGGNMCSGDIWDQISCHSPTACVSQAQCGEDFLCKETGRCLKRHLVCNG
DNDCLDGSDEDDCEDARVPEFDCSLYDPIPGSEKVALGYNILIQEEAQSVYDARYFGGQC
ETVYNGEWRELRYDPACEHLYYGEDEKYFRKPYNILMYHFVALADTRLSSELHEDAHDLL
SKVKNDISVSAGVTAGVGPVGSPVTVDVGASGSRGSLFLKELNKYNEKTYSFMRISTKVQ
TAHFKMRRDNIMLDEGMLQSLMELPEQYNYGMYAKFINDYGTHYITSGSMGGVYEYILVI
NREKMKSHDLTITDIKTCFGGFVGIEYDYSDRLSIGGQLSGGHCRKFGEGDEINNLKAMG
VEDIISRVRGGSSGWGGGLSENSSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTTLGP
LETKRRNLQLALDQYMMEFNACRCGPCFNNGEPILQGTSCKCQCPMGRTGSACEKMEEEG
AKADGRWSCWSSWSACRAGTQERRRECNNPAPQNGGASCPGGKVQTRAC
Download sequence
Identical sequences M3Y7B1
ENSMPUP00000007218 XP_004751679.1.14098 ENSMPUP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]