SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007239 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007239
Domain Number 1 Region: 544-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000536
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 2 Region: 124-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 64-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007239
Domain Number - Region: 498-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00971
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007239   Gene: ENSMPUG00000007296   Transcript: ENSMPUT00000007358
Sequence length 590
Comment pep:novel scaffold:MusPutFur1.0:GL896928.1:8469865:8513099:-1 gene:ENSMPUG00000007296 transcript:ENSMPUT00000007358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAGPQAWRALAELVLLCAALGAVGLPGSRGERPYCLESNAVNESLAKRRQTRSVGVVP
MPLDCELSSWSSWTTCDPCQKKRYRHVYLLQPSQFYGEPCNFSDKEVEDCVTSRPCRSQL
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCKKILKKCQHEMEQYWAIGRLASGIN
MFTNRFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYSPQTQGKYEFALTEYESYSDF
EKNVTETEESKFSFNFGFKIPGIVELGMNLKDENSKQFIRRIKRFSHTKSSFLHARSDLE
VAHYRLKARSLMLHYEFLQRVKLLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLIM
KKEAMEKADYSLKHVHACAQMGFRVGAALKVAYVKLGVSMELCQDILREIGERNKRNTMV
EDLVVLVRGGASEHITTLAYKEIPKAELMQEWGDAVQYNPEVIKIKTEPLYELVTATDFA
FSNTIKQNMKQALEEFQKEVSPCHCAPCQGNGFPVLKESRCECICPIGVHGTACEVTHEK
DVPIDGRWNCWSDWSPCSGGHKTRQRQCNNPPPQNGGNPCVGHASETLKC
Download sequence
Identical sequences M3Y7D2
ENSMPUP00000007239 XP_004751680.1.14098 ENSMPUP00000007239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]