SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007278 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007278
Domain Number 1 Region: 180-194,283-319,379-514
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-31
Family Nuclear receptor ligand-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-29
Family Nuclear receptor 0.0000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007278   Gene: ENSMPUG00000007335   Transcript: ENSMPUT00000007397
Sequence length 539
Comment pep:known scaffold:MusPutFur1.0:GL896921.1:6242075:6273359:1 gene:ENSMPUG00000007335 transcript:ENSMPUT00000007397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSSQDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMR
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSESARSAGLLDSG
MFVNIHQSGIKTESTVLMTPDKAESCQGDLSTLASVVTSLANLGKTKDPSQNSSEMSVIE
SLSNGDTSLCEFHQEVQTNGDVSRAFDTLAKALNPGESTACQSSVEGMEGSVHLIAGDSS
INYIEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALG
QENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSTERRKLLMEH
IFKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPGIETSPSYSKQCWGHLIHCWWECEMMH
Download sequence
Identical sequences M3Y7H1
ENSMPUP00000007278 ENSMPUP00000007278 XP_004748579.1.14098 XP_004748580.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]