SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007377 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007377
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 1.36e-23
Family Caspase recruitment domain, CARD 0.00000954
Further Details:      
 
Domain Number 2 Region: 109-193
Classification Level Classification E-value
Superfamily DEATH domain 1.6e-19
Family DEATH domain, DD 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007377   Gene: ENSMPUG00000007433   Transcript: ENSMPUT00000007497
Sequence length 199
Comment pep:novel scaffold:MusPutFur1.0:GL896921.1:7255308:7437999:-1 gene:ENSMPUG00000007433 transcript:ENSMPUT00000007497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGVLTENHVQEIKAQATGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLEKAREEAVTELPADDQMTGIPPHILNSSPSDQQI
NQLAQRLGPEWEPVVLSLGLSQSDIYRCKANHPHNVQSQMVEAFIRWRQRNGKQATFRSL
HRGLQAVEVDPSVLQHMLE
Download sequence
Identical sequences M3Y7S0
ENSMPUP00000007377 XP_004748598.1.14098 ENSMPUP00000007377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]