SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007420 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007420
Domain Number 1 Region: 364-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000000262
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000575
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007420
Domain Number - Region: 142-213
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000214
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 
Domain Number - Region: 223-335
Classification Level Classification E-value
Superfamily Prefoldin 0.00178
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007420   Gene: ENSMPUG00000007476   Transcript: ENSMPUT00000007540
Sequence length 514
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2621897:2627007:1 gene:ENSMPUG00000007476 transcript:ENSMPUT00000007540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGSGFCGRAFSCISACGPRPGRCCITAAPYRGVSCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITSVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNSRFAAF
IDKVRFLEQQNKLLETKWQFYQNRKCCESNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVMEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANAEALTEEIDFLR
RLYEEEICVLHAHISDTSVIVKMDNSRDLNMDCIVAEIKAQYDDIASRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQVSVTWGIPGHRGMCVPSG
SHHSCXEAALQKAKQDMACLVKEYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGVGAVN
VCVSSSRGGVVCGDLCVSGSRPVTGSACSAPCGGNLAVSTGMCAPCAPCAPCAPCAPCGP
CNSVTSCGLGTGGVGSCGISSCGVGSCASSCRRC
Download sequence
Identical sequences M3Y7W3
ENSMPUP00000007420 ENSMPUP00000007420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]