SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007502 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007502
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-25
Family SPRY domain 0.00082
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 9.56e-22
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-20
Family SPRY domain 0.0025
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.19e-16
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007502
Domain Number - Region: 385-423
Classification Level Classification E-value
Superfamily ARM repeat 0.00155
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007502   Gene: ENSMPUG00000007559   Transcript: ENSMPUT00000007623
Sequence length 539
Comment pep:novel scaffold:MusPutFur1.0:GL897339.1:161490:166200:-1 gene:ENSMPUG00000007559 transcript:ENSMPUT00000007623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPASGGRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKDRQPGDAAREPPDARLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLVEKAAQPHREKILNHLSTLRRDRDKIQGSQAKGEADILTALKK
IQDQRQNVMAEFKQAHEFLREREQHLLEKLEALQQELTEGREKYKSRGVTELARLALVIS
ELETKAQQPAAELLQDTRDFVNRYPRKKFWIGKPIARAVKKKTGEFSEKLQSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYSSLYQSAYLHPQQFDCEPGVLGR
KGFTWGKVYWEVEVDREGWSEEEEEGEEEEEGEEEEEEEEEAGYGDGYEDWETDEDEESL
GEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSAGIWANTDPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences M3Y845
ENSMPUP00000007502 XP_004781924.1.14098 XP_004781925.1.14098 XP_004781926.1.14098 ENSMPUP00000007502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]