SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007551 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007551
Domain Number 1 Region: 235-440
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.3e-54
Family Reprolysin-like 0.00042
Further Details:      
 
Domain Number 2 Region: 528-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1073-1122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 867-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000602
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 934-992
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000706
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 998-1059
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007551
Domain Number - Region: 824-872
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0327
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007551   Gene: ENSMPUG00000007606   Transcript: ENSMPUT00000007672
Sequence length 1169
Comment pep:novel scaffold:MusPutFur1.0:GL897032.1:2623826:2772931:-1 gene:ENSMPUG00000007606 transcript:ENSMPUT00000007672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKDEYDLVSPYEVDHNGDYVSHEITRSRRRRRGLAPLMVESLHLRLKGFRHDFHVELKA
SSNLMAPGFMVQTLGKGGTKSVRTFPPEDFCFYQGSLRSHKNSSVALSTCRGLSGMIRTQ
EADYFLKPLPSHLAGRLQDPARAGSPSHILYKRSADVRAPGAPQAVMTERDRELGNPALH
GSSDLRHPPKQHFCGRHKKYTPRPPRGDLFILPDEFAPHWRHKRSLLKSHRNKELNVETL
VVVDRKMTQNHGHENVTTYVLTILNMVSALFKDGTIGGNINIAIVGLILLEEEQPGLVIS
HHADHTLSSFCQWQSGLMGRDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYR
SCTVNEDSGLGLAFTIAHESGHNFGMVHDGEGNVCKKSEGNIMSPTLAGRNGVFSWSPCS
RQYLQKFLSTAQALCLADEPKPVKEYQYPEKLPGELYDANTQCKWQFGEKAKLCMLDFKK
DICKALWCHRIGRKCETKFMPAAEGTICGHDMWCRGGQCVKYGDEGPKPTHGHWSDWSSW
SPCSRTCGGGVSHRDRLCTNPKPSHGGKFCEGSTRTLRLCNSQQCPHNSVDFRALQCAEY
NDKRFRGWRYTWKPYTQVEDQHLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDG
ICERVGCDNVLGSDAVEDSCGVCRGNNSDCTTHKGLYANPHGANQYYQMVTIPPGARSIR
IREVNVSTSYISVRNTLRKYYLNGHWTVDWPGRYKFSGTTFDYRRSSHEPESLTSSGPTN
ETLVVELLFQGRNPGIAWEYSVPRLRGEKQPGGQPRYLWAVIRSECSVSCGGGQMTIRAG
CYRDLRFQVNTSFCSPRTRPVTGVVSCKVSACPPSWSVGNWSSCSRTCGGGTQSRPVQCT
RRANSVSERVAASLCPQPVPSSRQTCHSQSCPPAWSTGPWAECSRTCGKGWRKRSVACKS
TSPSARALLLPDAACGVEPKPRTHEDCLLKRCHKHKKLQWLVSAWSQCSGTCERGTQKRF
LRCAEKHVSGKYRELASKKCLHLPRPGVELERACALLPCPRHSLQAAAGPPRASWFAAPW
SQCTASCGGGVQTRAVQCLAGGRPALGCFVHQKPTASMACNTHFCPIAEKKDGVCRDHFP
WCSLVPRHGMCSHQFYGGHCCKTCSGSNL
Download sequence
Identical sequences M3Y894
ENSMPUP00000007551 ENSMPUP00000007551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]