SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007585 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007585
Domain Number 1 Region: 321-398
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-23
Family Intermediate filament protein, coiled coil region 0.00033
Further Details:      
 
Domain Number 2 Region: 90-124
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000303
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 135-199
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000309
Family Intermediate filament protein, coiled coil region 0.0061
Further Details:      
 
Domain Number 4 Region: 220-322
Classification Level Classification E-value
Superfamily Prefoldin 0.000022
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007585   Gene: ENSMPUG00000007640   Transcript: ENSMPUT00000007706
Sequence length 470
Comment pep:known scaffold:MusPutFur1.0:GL897098.1:2632173:2673148:-1 gene:ENSMPUG00000007640 transcript:ENSMPUT00000007706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIHLSSQVFSSRSAAFPGRGTQVRLSSVRPGGFSSSSVYGLGASRPRVAVRSAYGGPVG
AGIREVTINQSLLAPLRVDIDPSIQQVRQEEREQIKTLNNKFASFIDKVRFLEQQNKLLE
TKWALLQEQKSAKSSRLPGIFEAHIAGLQRQLEGLQLDGGRLEVELRNMQDVVEDLKNKY
EDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDSLNDEINFFKSLYETELAELQSQI
SDTSVVLSMDNNRSLDLDGIIAEVKAQYEEMANRSRAEAETMYQIKLETLQAQAGKHGDD
LRNTRNEIAEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDGHAKQEELEAA
LQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLGLGFGAGSFSLGNASTC
GLGSASGPARLLPPGADSSALQTGAPGGGCALCGSLACLGGLGCRGTRGY
Download sequence
Identical sequences M3Y8C8
ENSMPUP00000007585 ENSMPUP00000007585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]