SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007586 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007586
Domain Number 1 Region: 265-412
Classification Level Classification E-value
Superfamily TRAF domain-like 1.02e-46
Family MATH domain 0.00000137
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007586
Domain Number - Region: 86-108
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0549
Family SIAH, seven in absentia homolog 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007586   Gene: ENSMPUG00000007641   Transcript: ENSMPUT00000007707
Sequence length 415
Comment pep:known scaffold:MusPutFur1.0:GL897115.1:1352506:1371056:1 gene:ENSMPUG00000007641 transcript:ENSMPUT00000007707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPASSPRPAPDENEFPFGCPPTACQDPPEPRAPCCAACLSGNVRTSEDQICPKCRGD
GPQSVSPGSLQSQDKDHPEAAEAEAGCPFASVGCSYKGSPKLLQEHEVTSQTAHLNLLLG
FLKQRKAQQGVGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPHAESQDEQALKHF
MKEKLLAELEEKLRVFENIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVLELQQ
TLAQKDQALGKLEQGLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKY
GYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDA
FRPDLSSASFQRPQSETNVASGCPLFFPLNRLQSPKHAYVKDDTMFLKCIVETST
Download sequence
Identical sequences M3Y8C9
ENSMPUP00000007586 ENSMPUP00000007586 XP_004775665.1.14098 XP_004775666.1.14098 XP_004775667.1.14098 XP_004775670.1.14098 XP_004775671.1.14098 XP_004775672.1.14098 XP_004775673.1.14098 XP_004775674.1.14098 XP_004775679.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]