SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007598 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007598
Domain Number 1 Region: 410-487
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.76e-21
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Domain Number 2 Region: 180-214
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000068
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 72-146,497-550
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007598
Domain Number - Region: 220-288
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000418
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 
Domain Number - Region: 299-410
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007598   Gene: ENSMPUG00000007653   Transcript: ENSMPUT00000007719
Sequence length 559
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2650263:2658701:1 gene:ENSMPUG00000007653 transcript:ENSMPUT00000007719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRRAGPGLQP
PAAASAAAAIMSCLSSRLGAPCGVRAFSCASACGPRPSRCCITAAPYRGVSCYRGLTGGF
GSRSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITSVSVNESLLTPLNLEIDPNAQCVKHE
EKEQIKCLNSRFAAFIDKVRFLEQQNKLLETKWQFYRNRKCCESNLEPLFEGYIETLRRE
AECVEADSGRLASELNHVQEVMEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDL
EANTEALTEEIDFLRRLYEEEIRVLHAHISDTSVIVKMDNSRDLNMDCIVAEIKAQYDDI
ASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNTK
LEAAVTQSEQQGEMALSDARCKLAELEAALQKAKQDMACLVKEYQEVMNSKLGLDIEIAT
YRRLLEGEEQRLCEGIGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSACSASCSGNLAVST
GMCAPCGQRCSPSSLVRFP
Download sequence
Identical sequences M3Y8E1
ENSMPUP00000007598 ENSMPUP00000007598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]