SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007628 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000007628
Domain Number - Region: 51-97
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00607
Family FCH domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007628   Gene: ENSMPUG00000007683   Transcript: ENSMPUT00000007749
Sequence length 97
Comment pep:novel scaffold:MusPutFur1.0:GL896973.1:4850078:4854428:1 gene:ENSMPUG00000007683 transcript:ENSMPUT00000007749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCSGGRAFPAAPSLPGEAFSFLFCALQINCVTFPHPDTMPEQQLLKPTEWSYCDYFWAD
KKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRER
Download sequence
Identical sequences M3Y8H1
ENSMPUP00000007628 ENSMPUP00000007628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]