SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007642 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007642
Domain Number 1 Region: 124-194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 184-244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 71-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 4 Region: 20-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000227
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007642
Domain Number - Region: 398-518
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000113
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number - Region: 493-570
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000117
Family Fibronectin type III 0.011
Further Details:      
 
Domain Number - Region: 256-322
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0232
Family Fibronectin type III 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007642   Gene: ENSMPUG00000007698   Transcript: ENSMPUT00000007764
Sequence length 694
Comment pep:novel scaffold:MusPutFur1.0:GL896918.1:16086608:16215077:-1 gene:ENSMPUG00000007698 transcript:ENSMPUT00000007764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMCVCKYGFVGNGRTYCMDKNECQFGATVVCGNHTSCHNTLGGFYCICLEGYRATNNNK
TFIPNDGTFCTDIDECEVSGLCRQGGRCVNTYGSFECYCMDGYFPENGPEPFHPARDTTS
CIEIDCGLPPEVPDGLIVGNYTSRLGSQVRYACKEGFFSDLEDTVSSCTALGTWESPKLH
CQEIKCGRPPEVRHAVLVGNHSSSPGSVAHYVCQEGFESPGGKITSVCTEKGTWRKSALT
CTEIITEIRAVSVFNNTCVRWQVNPGSILSKTVYMIYIKGQRLYSMESVHEETVNVTTES
RTPEVCLDLHRGTNYTMSISTAPPMRSMPAIIGFQTAEDDLLEDGGIFNISVFSEACLKL
SRHPRKLGSEQMYQFQVLGQRWYLNNFYHATSFNFTTRERTPVVCLDLYPATDYTVNVTL
LGSSEQQSVQITMTTAPAVKQIIGNISVFNETCLRWRSTKTADTEEMYLFYIRGQRWYQK
EFAQEMTFNMTAHSQAPEMCLDLRPGTNYSIRIQAWSSQLPVVLPLTTHIAEPPPPEVDF
VTVHGGPLPRLKLRKAKEKNGPISSYQVLVLPLMLQNTFLCDSEGAASFFSNTSDAEGYV
AAELLAKDVPDDSMEMSIGDRLYYGKYYNAPLKKGNDYCIILRITSEWNEVRRCSCAVWA
QVKDSSFMPQQMVAVGLGSMAVVIVLAFLAFLAV
Download sequence
Identical sequences M3Y8I5
ENSMPUP00000007642 ENSMPUP00000007642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]