SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007716 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007716
Domain Number 1 Region: 240-563
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-88
Family Protein kinases, catalytic subunit 0.0000000812
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.2e-20
Family PB1 domain 0.00013
Further Details:      
 
Domain Number 3 Region: 104-173
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.28e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007716   Gene: ENSMPUG00000007773   Transcript: ENSMPUT00000007840
Sequence length 582
Comment pep:novel scaffold:MusPutFur1.0:GL897035.1:5808723:5894834:-1 gene:ENSMPUG00000007773 transcript:ENSMPUT00000007840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFLVTHVHPLCPRDILITSLDAAMTFEELCEEVREMCGLHHTHPLTLKWVDREGDPCTV
SSQMELEEAFRLACQRRDEGLAIHVFPSTPEQPGMPCPGEDTRVYRRRGARRWRKLYRAN
GHLFQAKRFNRRAYCGQCSERIWGLARQGYRCIHCQLLVHKRCHVLVPLTCKRRMDSVMP
SQEPAVDDKDDAGLPSEDTDGIVAYISSTRKHDVKEDSEDLQPVIDGMDGIKISQGLGLQ
DFDLIRVIGRGSYAKVLLVRLKKNDQMYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSN
PFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHER
GIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGF
SVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK
GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDEYGLDNFDT
QFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEESV
Download sequence
Identical sequences M3Y8Q9
ENSMPUP00000007716 ENSMPUP00000007716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]