SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007913 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007913
Domain Number 1 Region: 448-568
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 232-355
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-27
Family Cadherin 0.00069
Further Details:      
 
Domain Number 3 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-20
Family Cadherin 0.0058
Further Details:      
 
Domain Number 4 Region: 345-452
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 5 Region: 616-693
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000314
Family Cadherin 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007913
Domain Number - Region: 31-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0134
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007913   Gene: ENSMPUG00000007971   Transcript: ENSMPUT00000008038
Sequence length 1136
Comment pep:novel scaffold:MusPutFur1.0:GL896911.1:12937247:12955865:1 gene:ENSMPUG00000007971 transcript:ENSMPUT00000008038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRLLPLLLGLLGPGGYFFPPGHGQEVATLTVKYQVAEEVPSGTVIGKLSQELGWEEGRG
QMKTAFQVLQLSQALPIQVDPEDGLLSTGSRLDREQLCRQQDPCLVSFDVLATGDLALIH
VEIQVLDINDHEPQFPKGEQELEISESASLRTRIPLDRALDPDTGSNTLHSYTLSPSEHF
ALDVIVGPDETKHAELVVVKELDREIHSFFDLVLTAYDSGSPPKSGTSLVKVNVLDSNDN
SPMFAESSLALEIQEDAAPGTLLINLTATDPDQGPNGEVEFFLSKHVPPEVLDTFSIDAK
TGQVILRQRLDYEKNPAYEVDVQAKDLGPNPIPAHCKVLIKVLDVNDNAPSIHITWASEP
SLVSEALPKDSFIALVMADDLDSGNNGLVHCWLSQELGHFRLKRTNGNTYMLLTNTTLDR
EQWPEYTLTLLAQDQGLQPLSAKKQLSIQISDANDNAPVFERSRYEVSTRENNLPSLHLI
TVKAHDADLGLNGQISYRIQDSPVSHLVAIDSDTGDVTAQRSLDYEQMTSFEFRVIAEDK
GQPLLASSVSVWVSLLDVNDNTPEVIHPILSDGKASLSVLVNASTGHLLVPVETPNALGP
AGADTLPLATPSSRPFLLVAIVARDADSGANGELLYSIRRGNEARLFVLSPHLGQLFINI
TNASSLIGSEWELEIVVEDRGSPSLQTQALLRVLFVTSVDHLRDRAREPGTLSTSVLTVI
CLVVLLAIFGLILALIMSICRTEKKDNRAYNCREAESTYRHQPKRPQKHIQKADIHLVPV
LRGQPDEPGEVGQPHKEAGQEGMMEAGWDPCLQAPFHLTPTLYRTLRNQGNQGAQAESRE
VLQDTVNLLFNHPRQRNASRENLNLPEPQSVMGQPRSRPPKVTGSPTGRLPGDPGSEEAP
LSPPASSATLRRQPNLHGKVTPEKESGPRQILRSLVRLSVAAFAERNPVEELTMDSPPVQ
QISQLLSLLHQGQFQPKPNHRGNKYLAKPSGGRSTIPDPDGTGARAGGQAEPDQEEGCMD
PEEDLSVKQLLEEELSSLLDPHTGLALDRLSAPDPAWMARLSLPITTNYRDNVFSPDTPA
VEEPRTFQTFGKAPGPELSLTGTRLASTFVSEMSSLLEMLLEQRSGVPMEAASERD
Download sequence
Identical sequences M3Y9A6
ENSMPUP00000007913 ENSMPUP00000007913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]