SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007915 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007915
Domain Number 1 Region: 199-417
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.8e-69
Family Fibrinogen C-terminal domain-like 0.00000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007915   Gene: ENSMPUG00000007973   Transcript: ENSMPUT00000008040
Sequence length 422
Comment pep:novel scaffold:MusPutFur1.0:GL896928.1:13646617:13656043:1 gene:ENSMPUG00000007973 transcript:ENSMPUT00000008040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTNEIKEEEKE
LRRTTSKLQVKNEEVKNMSRELNSKLESLLEEKILLQKKVIYLEKQLTSLIKNQPEIQEH
PEVTSLKTFVEQQDNSIKDLLQTVEEQYRQLNQQHSQIKEIENQLRRTSIQESTENSLSS
KPRAPRTTPFLHFNETQNVEHNDIPANCTTVYNRGEHTSGIYPIRPSNYQVFNVYCDVKS
DRSWTLIQHRTDGSQNFNETWENYRYGFGRLNGEFWLGLEKIYSIVRQSNYILRIELEDW
NNNKHYIEYSFNLGNHETNYTLHLVEISGNVPSALPEHKDLVFSTWDHMAKEHVNCPESY
SGGWWWHNVCGENNLNGKYNKPRAKTKPERRRGLCWKSQNGRLYSVKSTKMLIHPKDSES
SE
Download sequence
Identical sequences M3Y9A8
ENSMPUP00000007915 ENSMPUP00000007915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]