SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007973 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007973
Domain Number 1 Region: 136-471
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.05e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000419
Further Details:      
 
Domain Number 2 Region: 37-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000103
Family Anticodon-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007973   Gene: ENSMPUG00000008031   Transcript: ENSMPUT00000008098
Sequence length 477
Comment pep:known scaffold:MusPutFur1.0:GL896994.1:848875:979100:-1 gene:ENSMPUG00000008031 transcript:ENSMPUT00000008098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGARCLVRALRSCSSTPCPRHKPSCRLSVRDALGAQNTIGEHVKVQGWIRSVRSQKEVL
FLHINDGSSLESLQVVADSSFDSRELAFGSSVEVQGQLVKSPSKKQNVELKAEKIEVVGN
CDAKAFPLKYKERHPLEYLRQYPHLRCRTNALASILRVRSEATAAIHSFFKDSGFVHIHT
PVITSNDCEGAGELFQVEPSSKIKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMVEAEISFVESLQDLMQVMEGLFKTATMMVLSNCPEDVELCHK
FIAPGQKDRLEHMLKNNFLIISYTEAIEILKQASQNFTFTPKWGVDLHTEHEKYLVKHCD
NIPVFVINYPLALKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGSLREERYHFLEQRLA
RSGLTEAYQWYLDLRRFGSVPHGGFGMGFERYLQCILGIDNIKDVIPFPRFTHSCIL
Download sequence
Identical sequences M3Y9G6
ENSMPUP00000007973 XP_004763524.1.14098 ENSMPUP00000007973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]