SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007996 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007996
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.87e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000038
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 76-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000171
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000044
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007996   Gene: ENSMPUG00000008054   Transcript: ENSMPUT00000008121
Sequence length 480
Comment pep:novel scaffold:MusPutFur1.0:GL896967.1:6049191:6450895:1 gene:ENSMPUG00000008054 transcript:ENSMPUT00000008121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSAAAWLLIGLSLGVPQFCKGDICDPNPCENGGVCLSGLSDNSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEAEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWTMYKVKGTNEDMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences M3Y9I9 U6CQK9
XP_004759178.1.14098 ENSMPUP00000007996 ENSMPUP00000007996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]