SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008018 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008018
Domain Number 1 Region: 347-469
Classification Level Classification E-value
Superfamily TIMP-like 1.88e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.024
Further Details:      
 
Domain Number 2 Region: 32-83
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000942
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008018   Gene: ENSMPUG00000008077   Transcript: ENSMPUT00000008144
Sequence length 471
Comment pep:novel scaffold:MusPutFur1.0:GL897163.1:1116006:1123767:1 gene:ENSMPUG00000008077 transcript:ENSMPUT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRCPPTPRPLQNLLLLWTFLNCGLGGSAQGPGEWTPWGSWSRCSSSCGRGLSVRSRRCV
WFPGEEPCWGDSHEYRLCRLPDCPLGAIPFRDLQCAIYNGHPVLGSQKTYQWVPFYGAPN
QCDLNCLAEGHAFYHSFGRVLDGTPCSPGTQGLCVAGRCLSAGCDGLLGSDAREDHCGRC
GGANESCLLVQRVFRDSGAFAGYWNVTLIPEGARHIRVAHRSRNHLALMGGDGRYVLNGN
WAVSPPGTYEAAGTRVVYTREAGPEEMLSAAGPTSQDLLLQILLQEPNPGIEFEFWLPRE
RYSPFQAQAQALGWSLRQQQPGAVDRQPSELPAAPATSVPRIPTPAPDPCAPCPDTRGRA
HRLLHYCGSDFVFRARVLSRRHQAQETRYEVQVQLIYKNRSPLRALEYVWALGRCPCPRL
DLHREYLLAAQRLISPDGTQDRLLLPHTGYARAWSPAEDSRVRLAARHCPR
Download sequence
Identical sequences M3Y9L1
ENSMPUP00000008018 ENSMPUP00000008018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]