SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008134 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008134
Domain Number 1 Region: 44-119
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.000000000000351
Family Cyclophilin (peptidylprolyl isomerase) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008134   Gene: ENSMPUG00000008194   Transcript: ENSMPUT00000008263
Sequence length 120
Comment pep:novel scaffold:MusPutFur1.0:GL897018.1:197937:201752:1 gene:ENSMPUG00000008194 transcript:ENSMPUT00000008263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEQTSWSFCIWRLHGFGTCWHNTRAFQEFMNKKKPSLSPSHGQPYHFPQCGIGGELLGS
ISFQLFADESPKIAENLHVVSAGEEESCFHRIILGFMCQVVTSFHNRPGGKSIYGVKFTE
Download sequence
Identical sequences M3Y9X7
ENSMPUP00000008134 ENSMPUP00000008134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]