SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008254 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008254
Domain Number 1 Region: 232-340
Classification Level Classification E-value
Superfamily TPR-like 3.8e-28
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 2 Region: 1955-2002
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000217
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 489-605
Classification Level Classification E-value
Superfamily TPR-like 0.000000159
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008254
Domain Number - Region: 822-897
Classification Level Classification E-value
Superfamily DEATH domain 0.0141
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008254   Gene: ENSMPUG00000008316   Transcript: ENSMPUT00000008386
Sequence length 2007
Comment pep:novel scaffold:MusPutFur1.0:GL896984.1:1091026:1220130:1 gene:ENSMPUG00000008316 transcript:ENSMPUT00000008386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDFALGDFTVADDALLEDCPYMDDFVFAPEFMSNDYVRVTQLYCDGVGMKYKDFTQSER
NLEFDICNMWCSKPVSVLQDYCDAIKIYIFWPLLFQRQHSSIISRLHPCVEATNSHASEI
SLKKLQHLELMEDIVDLAKKVVNDSFFIGGLLRIGYKIENKILAMEEALNWVKYTGDVTI
LPKLGAVDNCWPMLSIFFTEYKYHITKVVTENCNLLEEFKTQNCAECIEQGELMKMKGNE
EFSKERFDIAIIYYTRAIEYRPENHLLYGNRALCFLRTGQFRNALGDGKRAIILKSNWTK
GHYRYCAALSMLGEYDWALQANIKAQKLCKNDPEGIKDLIQQHVKLQKQIEDLQGRTPTR
NPIKAFYESRAYIPSLSAPAFSTSLNFVETEKDSRKSNHEMANGGNQNLKVVDEALKADD
CDCHPEFLPPSGQPPKYKGKQKSRNNELEKFSSSSQGSLPVDLKNILEKQFSKSSRAAHQ
QDFANIMKMLRSLIQDGYTALLEQRCRSAAQAFTELLNGLDPQKIKQLNLAMINYVLVVY
GLAISLLGIGQPEELSEAENQFKRMIEHYPNEGLDCLAYCGIGKVYLKKNRFLEALNHFE
KARTLICRLPGVLTWPTSNVIIEETQPGKIKMLLEKFIEECRFPPVPDAICCYQKCRGYS
KIQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCEG
IISKIIIFSSGGQVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKKLKRKIQKKEA
KKLAQERMEEDLRESNPPKTEEQKETADNVQSCQFLDDRILQCIKQYADKIKSGILNTSK
LLKELLSWKVLSTEDYTTCFSSRNFLNEAVDYVIRHLIQEKNRVKTRIFLHVLSELKEVE
PKLAAWIQKLNSFGLDATGPFFSRYGASLKELDFSIMTFLWNEKYGHKLASIEGKQLDYF
CEPTSLKEARCLIWLLEEHRDKFPALHNALDEFFDIMDSRCTVLRKQDSGDVLFNSSKIK
NKGKKKKPKDLKLRLVVETEFSGNEQTHEEIKVVSSSDLFIRNSNPAGPFVVPDHLRQDV
EEFEAIYEQHSSEYVVRNKKLWDINPKQKCSTLYDYFSQLLEEHGPLDMSNKMFSEEYEF
FPEETRQILEKAGGLKSFLLGCPRFVVIDNCIALKKVALRLKKKRKKKNIKTKVEEISKT
GEYLRVKLPLNPSAREFKPDIKSKPVSDLSSAAASEDVKPKPIAANSPKPTCEAVKPKPM
SDNSSRSVSEDEKPKEVSSDSPKPVSEDAGHKRVSSHSPKPASEDVKPTYWTQPHLVTGY
CTYLPFRGFGITQTPPTYINVLPSLPQYTNIYTPLANVSSEYQLQRSVPVVPSFIANDRP
DESAAVYFEGHHLNAENAPGNQIAPKTQIPQDSLEVSVKTQHSTDGADAAFSESNRCDGH
CGNAANKREVNPETTNEVTNTPRTQVVAIQVSWNVTHQEVNTEPYDPFEAQHGDILQIEK
EYQVLQEQLKEACENYEQRKLKGSEETRDLEEKLKRNIEENKISKTELDWFLEDLEKEIK
KWQQEKKEIQESLKALTKKMRKVLNASETRTQENDGKEKEHELLLDQSLEISNTFTNEKM
KVEECIKKGKENYEESLQRAVAAEVSVLENWKDMVVYKLQILESQAEGYLKSLKLLGSDS
ATYPDMKSDVHSWESFLSKVRKETEKAKSQYEEQIQAIKNGSRLSELPKVEIPQLSFPIC
STVLPAGLPESSGHEDHGTSTSSSHGPGNQTAVPEDSGLVSASDGPVGASSPPLTGLLCH
QPEVPQLPEYKSTSHETPPKQSLVADQKLPVLPGRATRSSQSPKKPFNSIIEHLSVVFPC
YNSTELAGFIKKVRNKNKNSLSGLSIDEIVQRVTEHILDEQKKRKPNSNSGKDKKLSEAN
SAASMTRASQGPSSMIAGPSPKTKGQKTEDSPVDLASGAASCELCHDIFKSKNVRALKCG
HKFHKGCFKQWLKGQSSCPACLAQDLL
Download sequence
Identical sequences M3YA97
ENSMPUP00000008254 ENSMPUP00000008254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]