SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008256 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008256
Domain Number 1 Region: 629-748
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 531-632
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 205-314
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 314-417
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-19
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 736-846
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-17
Family Cadherin 0.0066
Further Details:      
 
Domain Number 6 Region: 452-536
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000004
Family Cadherin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008256   Gene: ENSMPUG00000008318   Transcript: ENSMPUT00000008388
Sequence length 952
Comment pep:novel scaffold:MusPutFur1.0:GL897279.1:478024:484464:1 gene:ENSMPUG00000008318 transcript:ENSMPUT00000008388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRGNARSSRALAVSWRPAIWHPRLDMGRLSRPRSSTSHRNLPHLFLFFLFVGPFNCLA
SYSRATELLYSLNEGLPAGVLIGSLAEDLRLVPRAAGRQDQLSQLPERPVAERNPPLSFS
LASRGLSGQYVTLDNRSGELHTSAQEIDREALCLEGGGGAAWGGSISISSSPSSDSCLLL
LDVLVLPQEYFRFVKVKIAIRDINDNAPQFPVSQISVWVPENAPINTRLAIEHPAMDPDV
GTNGVQTYRLLDYHRMFTLDVEENENGERTPYLIVMGLLDRETQDQYVSIIIAEDGGSPP
LLGSATLTIGITDINDNCPLFTDSQINVTVFGNATVGTPVAAVQAVDRDLGTNAQITYAY
SQKVPQASKDLFHLDETTGVIKLFSKIGGSVLQMHKLTILANGPGCIPAVTTALVTIIKV
IFRPPEIVPRYIANEVDGIVYLKELEPINTPIAFFTIRDPEDKYKVNCYLDGEGPFRLSP
YKPYNNEYLLETTKLMDYELQQFYEIAVVAWNSEGFHVKKIIKVQLLDDNDNAPIFLQPL
LELTIEENNAPNAFLTKLYATDADSGERGQVSYFLGPDAPSYFSLDSVTGILTVSTQLDR
EEKERYRYTVRAVDSGKPPRESVATVALTVLDKNDNSPRFINKDFSFFVPENFPGYGEIG
VISVTDADAGRNGWVALSVVNQSDIFVIDTGKGMLRAKVSLDREQQSSYTLWVEAVDGGE
PALSSTAKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAV
IAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMV
NLFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVSCVPTLVALSVISLG
SLTLVTGMGIYICLRRGKKHHREDENLEVQIPLKGKIDLHMRERKPMAISNI
Download sequence
Identical sequences M3YA99
ENSMPUP00000008256 ENSMPUP00000008256 XP_004781263.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]