SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008259 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008259
Domain Number 1 Region: 966-1241
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.6e-55
Family Patatin 0.049
Further Details:      
 
Domain Number 2 Region: 181-319
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-24
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 631-749
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.82e-22
Family cAMP-binding domain 0.009
Further Details:      
 
Domain Number 4 Region: 514-633
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-19
Family cAMP-binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008259   Gene: ENSMPUG00000008321   Transcript: ENSMPUT00000008391
Sequence length 1366
Comment pep:known scaffold:MusPutFur1.0:GL897062.1:3792013:3814590:-1 gene:ENSMPUG00000008321 transcript:ENSMPUT00000008391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRQGPAVTSSGAENLTEWGGDGGVPASGEGSAGRVCDAQPVPFVPQVLGVMIGAGVA
VLVTAVLILLLVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDASVS
TTSRPRMKKKLKMLNIAKKILRIQKEAPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLY
MLKNVRVLGHFEKPLFLELCRHMVFQRLSQGDYVFRPGQPDASIYVVQDGLLELCLPGPD
GKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKY
PESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPARTSPVRGSK
RVVSTSATEEPRESPGRPPDPTGAPLPGPAGDPVKPTSLEAPSAPLLSRCISMPVDISGL
QGGPRSDFDMAYERGRISVSLQEEASGGPQAAPARTPTQEPREQPAGACEHSYGEDELAA
GGCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVS
LHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRIS
KSDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYI
VLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTL
GHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPGSGLGVPPHSELTNPASNLATVAVLP
VCAEVPIVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDAH
RIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHR
EEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSKRADRHSDFSR
LARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSA
SRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNV
TTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSM
GAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKIKVPDMAEIQSRLAYVSCV
RQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRGDIIEKMLTD
RRSADLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAG
PDCSRDEGGSPEGASPSTASEMEEEKSLLRHRRCLPLDPPGSAAEA
Download sequence
Identical sequences M3YAA2
ENSMPUP00000008259 ENSMPUP00000008259 XP_004771775.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]