SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008281 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008281
Domain Number 1 Region: 442-576
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-29
Family Cadherin 0.0031
Further Details:      
 
Domain Number 2 Region: 237-342
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-27
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-25
Family Cadherin 0.0063
Further Details:      
 
Domain Number 4 Region: 342-446
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-19
Family Cadherin 0.008
Further Details:      
 
Domain Number 5 Region: 558-668
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-16
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 32-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000089
Family Cadherin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008281   Gene: ENSMPUG00000008344   Transcript: ENSMPUT00000008414
Sequence length 800
Comment pep:novel scaffold:MusPutFur1.0:GL896911.1:13677069:13702891:-1 gene:ENSMPUG00000008344 transcript:ENSMPUT00000008414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERMAVAHRKLLQSRQVGSLLFMLCVSVGSAATIRYSVAEEMESGSFVANVAKDLGLEVGK
LAARGARLVSEGNKLHFRLHRKTGDLFVKEKLDRESLCGKADPCVLHFEIVLVEPLQSFR
VEVRVFDINDNAPIFLNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSRNAYF
HLHTRFRSHGPKYAELVLDKPLDREDQPEVNLTITAVDGGSPPKSGIAHIRVEVLDVNDH
VPQFSRLVYRAQVLENSANGSLVATVSATDLDEGSNKEITYSLAQNPEAVLQTFQVDSHT
GEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDVNDNPPEVTVSSVSSPLPE
DSPLQTVVALFSIRDRDVRVGGKITCFLREDLPFAVKPTFRNSYSLVTDRGLDREEVSGY
NITIVAMDTGPPSLFTETVIEVLIADINDNPPVFQEDSYILTVRENNSPAIFIGKVYAED
LDLGENAQVTYTLLPPQSGDLSVFAYISINSDNGKLYALRTMDYEAIQNFQFVVKATDGG
FLSLSSQVTVRVVVLDDNDNRPMILYPLQNGTLPCNDLVPRSADAGFLVTKVVAVDGDSG
QNSWLSYHLLKATDPGLFSVQQQNGEEVRTARPLSERDAVKHRLLVLVRDHGEPPLSASV
TLHVLLVDGFSQPYLPLPDAAAAEARADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRR
RRAASGAGCSVPEGPFPGHLVDVSGAGTLSHSYQYEVCLTGGTGANEFKFLKPILPSFLA
LGEERISEASPSFRDNFEFN
Download sequence
Identical sequences M3YAC4
ENSMPUP00000008281 ENSMPUP00000008281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]