SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008297 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008297
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-26
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 262-378
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-25
Family Cadherin 0.00083
Further Details:      
 
Domain Number 3 Region: 373-495
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-25
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 74-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000157
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 482-590
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000842
Family Cadherin 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008297
Domain Number - Region: 579-649
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.054
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008297   Gene: ENSMPUG00000008360   Transcript: ENSMPUT00000008430
Sequence length 794
Comment pep:novel scaffold:MusPutFur1.0:GL897180.1:1134635:1389405:-1 gene:ENSMPUG00000008360 transcript:ENSMPUT00000008430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRNCLSLLLWVLFDGGLLTPLQPQPRQTLATEPTENVIHLPGRRPHFQRVKRGWVWNQ
FFVLEEYMGSEPQYVGKLHSDLDKGEGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDRE
EKPFYTLRAQAVDIETRKPLEPESEFIIKVQDINDNEPKFLDGPYVASVPEMSPVGAYVL
QVKATDADDPTYGNSARVVYSILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAK
DMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPIGSAIGRIRAVDPDFGQ
NAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEASNVHLDHRFH
SAGPFKDTATVKISVLDVEEPPVFSKPLYTMEVYEDTPIGTIIGAVTAQDLDVGSSAVRY
FIDWKSDGDSSFTIDGTEGTIATNELLDRESTAQYNFSIIASKVSNPLLSSKVNILINVL
DVNEFPPEISVPYETAVCENAKPGQIIQIVSAADRDLSPAGQQFSFRLSPEATIKPNFTV
RDFRNNTAGIETRRNGYSRRQQELYFLPVVIEDSSYPVQSSTNTMTIRVCRCDSDGTILS
CNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKDTLMTSKEDIRDNVIHY
DDEGGGEEDTQAFDIGALRNPKVIEDNKIRRDIKPDSLCLPRQRPPVEDNTDIRDFINQR
LQENDVDPTAPPYDSLATYAYEGNGSVADSLSSIDSLTTEVDQDYDYLTDWGPRFKVLAD
MFGEEESYNPDKVT
Download sequence
Identical sequences M3YAE0
ENSMPUP00000008297 XP_004778727.1.14098 ENSMPUP00000008297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]