SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008337 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008337
Domain Number 1 Region: 238-472
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-58
Family DBL homology domain (DH-domain) 0.0000383
Further Details:      
 
Domain Number 2 Region: 473-599
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-37
Family Pleckstrin-homology domain (PH domain) 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008337
Domain Number - Region: 1101-1157
Classification Level Classification E-value
Superfamily Cloacin translocation domain 0.0212
Family Cloacin translocation domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008337   Gene: ENSMPUG00000008399   Transcript: ENSMPUT00000008470
Sequence length 1170
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:3855347:3872381:-1 gene:ENSMPUG00000008399 transcript:ENSMPUT00000008470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTVGTNFLPSRPAVSANTVGEDAALSRRITRKYKNGAARPRTALGLGAPTVNMGNTHSK
TSDRHSAHHGRPELSFYSSFPRKWSENVFLDNELLTSKILSVLRPQSERGFRTGPLRYPA
HFLSTNSVFASVAASLKEHPRATLLSDGSPALSRNVGMTVSQKGAPQPAPSPAGTGTQLG
PIAGEMDEADSVFLKFKQAADDSLSLTSSSAEPIFVEDPCTASLRSEIESDARDFEAESW
SLSVDAAYAKTQKKEVVKRQDVLYELVQTEVHHVRTLKIMLKVYSRALQEELQFSSKAIS
RLFPCVDELLDLHSHFLSRLKERRQESLEEGSDRNYVIQKIGDLLVQQFSGENGDRMKEK
YGVFCSGHNDAVSHYKLLLQQNKKFQSLIKKIGNFSIVRRLGVQECILLVTQRITKYPVL
VERLIQNTEAGTEDYRDLTQALNLIKDIISQVDAKVSEYEKGQRLREIAGKMDLKSSSKF
KNGLTFRKEDMLQRQLQLEGPLCWKTTSGRLKDVLAVLLTDVLLLLQEKDQKYVFASVDS
KHPVISLQKLIVREVANEEKAMFLISASLRGPEMYEIYTSSKEERNTWMAHIRRAVESCP
DEEEGPFSEAEEEKKVFEARALRLRDFQERLNVKDQQIAQSLGEKQQIYLEMAEMSGLED
IAQSRLLFRGGDSSETTQGELILKSAMSEIEDIQTLICRQLGSTNSQVEDGGGSAGLPRR
AETFGGYDTVSSPGKNGSLKKASSSDPGPRDWQGPVRSPDSQPSSPREPPEEAPPAVTVP
GVECGPRQPLVLEFELVQRIQTLSQLLLSLQAVIAQQDSCVEMQRASIQEREKQLRLQST
RGNMLLEQERQRNFEKQREELAGVQKQQGRLRQEQQRWERERERQQQELDLAAARLRQRE
SEAARLQEQLSQERERLEQQRRAYQHDLERLREAQRAVERERERLEQQRRLKKQNTLPGA
LPPDSLAEAQPPSHTPSFNGDGLEGPAALAKAPGARASVLLSGAGPEFAERPEVARRDSA
PAESRPAKSDVPIQLLSTTNQLQRQTAVQQQIPTKLAASTKGGKDKGGKSRGSQRWDSSA
SFDLKQQLFLSKLVGKDENTARNRRSLSPVLLGSHGSVPSAEPCCPAPADVPPECFSLKP
GGTPVPPSPLPLPATPLGKEDSNKEDVIFF
Download sequence
Identical sequences M3YAI0
ENSMPUP00000008337 ENSMPUP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]