SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008374 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008374
Domain Number 1 Region: 674-736,768-917
Classification Level Classification E-value
Superfamily RNI-like 2.22e-32
Family 28-residue LRR 0.00066
Further Details:      
 
Domain Number 2 Region: 72-156
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-21
Family Pyrin domain, PYD 0.0047
Further Details:      
 
Domain Number 3 Region: 236-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000712
Family Extended AAA-ATPase domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008374   Gene: ENSMPUG00000008438   Transcript: ENSMPUT00000008509
Sequence length 948
Comment pep:novel scaffold:MusPutFur1.0:GL897275.1:99398:105155:1 gene:ENSMPUG00000008438 transcript:ENSMPUT00000008509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQSLGAKPRSPLHASPPRECSLEQRGLVGAADRRAPRGRVGWEAGQGRGPRNHMRVDRH
RPPAPSTEARAAKARDLLQAALEDLSQEQLKRFRHKLRDAALDGRSIPWGRLERADAVDL
AEQMIQFYGPEPALDVARKTLKRADVRDVAARLKEQGLQWFSPGSSALLSVSEYKKKYRE
HVLQQHAKVKERNARSVKINKRFTKLLIARESAALVDEAPGLAEEPEPERARRSDTHTFN
RLFGRDEEGQRPLTVVLQGPAGIGKTMAAKKILYDWAVGKLYHDQVDFAFFLPCRELLER
PGPCSLARLVLDQCPHRSAPVRQMLARSERLLFILDGADELPPGPADAAPCTDPFEEADG
ARVLDGLMSKTLLPGARLLVTARATAPGRLQGRLCSPQCAEVRGFSDKDKKKYFHKFFRD
ERMAERAYRFVKENETLFALCFVPFVCWIVCTVLRQQLQLHQDLSRTSKTTTSVYLLFIT
SVLSSAPATDGPQMQEELRKLGRLAREGTLRHRAQFPEKDLERLELRGSKVQTLFLSKKE
LPGVLETEVTYQFMDQSFQEFFAALSYLLEQEKALEAPADSVGALLQGGTELRGHLTLTT
RFLFGLLNGERLRDIERHFGCGGVVSKRVKQDVLRWVQEQGQGHPRAAPEGTEETEAPEG
SQEPEEEEEGELSYPLELLYCLYETQESTFVHQALRGWPELLLERVHFSRLDLLVLSYCV
RSCPAGQALRLVSCVLVPPQEKKKKSLIKRLHGSLSGSSSQATARKSQASPLRTLFEAMT
DQHCGLHSLTLCRCRLPDSICRDLSEALREAPALRELGLLHNRLSEAGLRVLSEGLAWPQ
CRVQKLRVWQPRLQEAFQYLTSVLRQSPALTILELGDCQLSEPTVTDLCAVLQHPGCRLQ
TLRLTSVQLSEQSLKELQVVKTAKPDLVITHPALDGHPRPPAGHSSAL
Download sequence
Identical sequences M3YAL7
ENSMPUP00000008374 ENSMPUP00000008374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]