SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008431 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008431
Domain Number 1 Region: 428-759
Classification Level Classification E-value
Superfamily L domain-like 1.05e-61
Family Internalin LRR domain 0.011
Further Details:      
 
Domain Number 2 Region: 146-462
Classification Level Classification E-value
Superfamily L domain-like 2.89e-59
Family Internalin LRR domain 0.075
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008431
Domain Number - Region: 766-859
Classification Level Classification E-value
Superfamily DEATH domain 0.0002
Family DEATH domain, DD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008431   Gene: ENSMPUG00000008496   Transcript: ENSMPUT00000008567
Sequence length 869
Comment pep:novel scaffold:MusPutFur1.0:GL897130.1:1581203:1605331:1 gene:ENSMPUG00000008496 transcript:ENSMPUT00000008567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKEGTSEELEDTTSQLRTESTSWAMEPEFIKETSNSLAEPYVGKPSNQICETNPRNDE
LGIHDDASTLSLENKSKRDEEQRKTLQFSDTITTYKSLQLKSDIPQSPPLSVTGMVAGYQ
AFPGFLSHETLETISPQLSEEYQKGLDLGSDNFTVNLKAKGLQEFPKDILKIKYVKYLYL
DKNHIKSFKGADSGDLLGLEILSLQENGLSSLPPEIQLLHNLRILNVSHNQISHIPKEIS
HLRNIRQLFFNDNYIENFPSGLESLGNLEILSLAKNKLSHIPDTLSSFKNLKVLNLEYNQ
LTIFPKVLCFLPKLISLILTGNLISSLPKEIRELKNLENLLLDHNKLTFLAVEIFQLFKM
KELQLTDNKLEVISHKIENFKELKILILDKNLLKEIPEKISHCIMLECLSLSYNKLTGLP
KNIYKLKNLRELYVNKNNIVRIPEDISHLHNIFILEFSGNIITDVPIEVKNCKKITKVEL
SYNKIMYFPVGLCALDFLNYLNFNGNYISEIPVDISFSKQLLNLELNKNKLLKFSEHLCS
LINLEYLDLGENQIRKIPPSISNMVSLHVLILCCNKFEAFPIEVCTLENLQVLDLSVNQI
QNIPSDICNLKRIQKFNISSNQFIYFPIELCQLQSLEELNISQMNGRKLTRLPEELSTMT
QLKRLDISNNAIREIPRNIGELRSLVSLNAHNNQISYLPPSFLCLNDLQQLNLSGNNLTV
LPNGIHNLFSLKEINFDDNPLLRPPMEICKGKQLYTIAHYLQRADQRDEKILEKIFNIVA
NNITETSFKFLCQKLNLVISETDISSKSTVSLSERVRQALDRWKTDSNNLSLTTDALRDQ
LTQALTMIGAYEIMDKITALKLFTCAIKF
Download sequence
Identical sequences M3YAS4
ENSMPUP00000008431 XP_004776498.1.14098 ENSMPUP00000008431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]