SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008462 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008462
Domain Number 1 Region: 556-675
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 224-335
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-22
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 330-450
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-20
Family Cadherin 0.0047
Further Details:      
 
Domain Number 4 Region: 665-774
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000002
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 134-230
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000728
Family Cadherin 0.013
Further Details:      
 
Domain Number 6 Region: 443-560
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000228
Family Cadherin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008462   Gene: ENSMPUG00000008527   Transcript: ENSMPUT00000008598
Sequence length 954
Comment pep:novel scaffold:MusPutFur1.0:GL897014.1:1262812:1285555:1 gene:ENSMPUG00000008527 transcript:ENSMPUT00000008598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAGRGAADARVRLLACSLAEKGKARPCELEKNVPVPGITASRCSRLPAAGGAGLARGP
PPPPLSALHSARPGACSALLRPARLWRTILSARGDMRRSPGAALALGLLRLCLAQANFAP
HFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGTDPEGDPVSYHISFDPSARSVFSVDP
NFGNITLVEELDREREDEIEAIISISDGVNLVKEKVTILVTDANDEAPSFIQEPYVVQVP
EDLPTGSSIMKVHAVDKDTGSGGSVTYFLQNVHATKFALDHHSGVLRLRAGATLDYEKAR
AHFVTVVAKDGGGRLRGANVIFSTTTTVTVNVEDVQDMPPVFVGTPYYGYVYEDTLPGSE
VLMVVAMDGDRGKPNQIVYSLLNGSDGAFEINETSGVISVMQSPAQLKREVYELHVQVTE
VSSAGIPAAQAMVPVTIRIVDLNNHPPTFYGESGPQNRFELSMYEHPPQGEILRGLKITV
NDSDQGANAKFNLRLVGPGGIFRVVPLTVLNEAQVTIIVENSAAIDFEKFKVLTFKLLAI
EVNTPEKFSSTADVVIQLLDTNDNVPKFTSHYYIARIPENSPGGSNVVAVTAVDPDTGPW
GEVKYSIYGSGADPFLIHPSTGIIYTQPWAILDAEATARYNFYVKAEDMEGKYSLAEVFV
TLLDVNDHYPQFGKSIQEKTMVLGTPVKIEATDQDAEEPNNLVDYSITHVEPANVFDIDV
HTGEIRLKNSIRSLDALHNITPGGDFTWSLEVQAKDRGSPSFSTTALLKIDITDTEMLSR
SPMAAFLMQTKDNPMKAVGVLAGIMAIIVAITVLISTATFWRNKKSNKVLPVRRVVRKRP
SPAPRAVRIEWLKFKRTKAAAKFVLKEDPSNENCNNNSLGSTLPPKAPAPPPPPTMAPKM
GVAPWTVPTVSGSLTPQQPQRSPKPKVGSPVQSALVSELRQKFEKKNVGNKAYF
Download sequence
Identical sequences M3YAV5
ENSMPUP00000008462 ENSMPUP00000008462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]