SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008598 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008598
Domain Number 1 Region: 328-527
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000373
Further Details:      
 
Domain Number 2 Region: 219-295
Classification Level Classification E-value
Superfamily SH3-domain 9.08e-16
Family SH3-domain 0.003
Further Details:      
 
Domain Number 3 Region: 106-203
Classification Level Classification E-value
Superfamily PX domain 0.000000011
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008598   Gene: ENSMPUG00000008667   Transcript: ENSMPUT00000008739
Sequence length 2048
Comment pep:novel scaffold:MusPutFur1.0:GL896998.1:1211995:1397871:-1 gene:ENSMPUG00000008667 transcript:ENSMPUT00000008739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSVHSEEDDFVPELHRNVHPRERPDWEETLSTMARGADVPEIPGDLSLKTCGSTASMK
VKHVKKLPFTKGHFPKMAECAHFHYENVEFGSIQLSLSEEQNEVMKNGCESKELVYLVHI
ACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDALKDSPESVTQMLMAYLS
RLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTL
EVGDIVSVIDMPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHG
KLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYG
IVDGIYRLSGVASNIQRLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTY
QLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKN
LAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLFSGKISAVIQDGAA
SLSRPKSLLVSSPSTKLLTLEEAQARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIE
FPLERRRPQNKMKKSPVGSWRSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGT
LRSAKSEESLTSLHAVDGDSKLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNES
EDEVGPLHIPALMSPHAAEDVDLSPPDIGVASLDFDPMSFQCSPPKLESECLESGASFLD
SLGYSQEKISSNKKDTEAGGSQSQTPGSTASSEAVSPLQEKLSPFFTLDLSPTEEKSSKP
SSFTEKVVYAFSPKIGRKLSKSPSINISEPISVTLPARVSEVIGTVSNTAAPSASSPTWS
KSVEDNEAINRSPTQVVKMKTSERDAQGACECEVQPLEQGAAAEVESPGKEEQVVASSQS
KAVPSGQTQTGAVTHDPPQDSVPVSSVSLIPPPPPPKNVARLLALALAESAQQASTQSLR
RPGTSQAAYTNYGDIAVVAAEEKLPSSYSSVTLDKAYFQTDRPAEEFHVQNNVSGNCDQP
IPDLAATGNLTYASATESGEQLHQADFPGNHPHRTYLPGDPDKARITSVPLTDSKSDDPL
SFPEDQSGKTNMPTVSFMEQDQCQLHFYSGDQPPSYLGAGVDKPHHHPSELADKSPTPSN
LPRDKSYPPSGSPEENPSTAAMAYMTAAPATAEMSTREASWDVAEQATAADFATATLQRP
PRTNRPLPPPPSQRSGEQLPVVGQVQTAASVGLNNSHKVQVIPAPERPPDPRATDDPAPI
LVGDGGAAAQCPVSAPALQPSLPEKVREGARAPPLHLRADSVPVYSSCGFPMPVPPTRTM
ESKIAATLHSSGADAPSSSGYHPFATASPASVDDGLPLPIPIPQPKHASQKTTYSTFARP
DVTPEPFGPENCVHFSMNPNCQYRPQSVPPHHNKLEQHQVYGARSEPPASMGPRYNTYVA
PGRNASGHHSKPCSRVEYVSSLGPTIRSSCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPI
SRTEVPPDDEPAYCPRPLYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSS
YYSPEGALCDVDAYSTVQLRPLHRLPNRDFAFYNPRLQGKHLHTYAGLLPRPRANVTGYF
SGNDHSVVNMPPAADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPA
MQDDLGGIYVIHLRSKSDPGKTGLLSVAEGKEGRHPTKVVSPEGEDRFYRKHPEPEFDRA
HHHGGYGNGPPEKPTLPQKQSSLRNRKLHDMGCSLPEHRAHQEASHRQLCESKNGPPYPQ
GAGQLDYGPKGIPDTSEPVSYHNSGGKYITSGQESLRLNHKEVRLSKELERPRARQPPAP
EKHSRDCYKEEEHLPPSVVPPPKPERSHSLKLHHTQNVERDPGVLYQYQTHGKRQSSVTV
VSQYDNLEGYHSPPQHQRGGFGGGAVGTYVPSGFPHLQNRTYATALGQGAFLPTELSLQH
PETQIHAE
Download sequence
Identical sequences M3YB91
ENSMPUP00000008598 ENSMPUP00000008598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]