SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008630 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000008630
Domain Number - Region: 68-102
Classification Level Classification E-value
Superfamily DEATH domain 0.0553
Family DEATH domain, DD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008630   Gene: ENSMPUG00000008700   Transcript: ENSMPUT00000008772
Sequence length 524
Comment pep:novel scaffold:MusPutFur1.0:GL897073.1:2624284:2632407:-1 gene:ENSMPUG00000008700 transcript:ENSMPUT00000008772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFAEEKTYEYIRYHYSSFVDRIHVLEILPYLSCLTTSDQDRLRASCQLSGNQGTLWELF
NSLRRRIGWVESLISALRACELVDLADEVARIYYSNLPGVRNRPPAPVEPQLVPAEVPRS
SKPAVAPRAPHNGYREEEPSFPLPVQDTQPAESPEESSKKVPPMPHSGDVLRRPAGPLET
SSDMAAFNPLTFSGHQEQDTELGGAHTPGTASSLPSSRGPVSPSVSFQPLSRSTHRASRL
PAPSAAAPSAGTSSSSMGLACAGGSGDHREAGVCSTGPGVSTSSLTTSIASSRVPASSAL
DRAVPSKLPASSKPSGAVATNVLTSLPPSKLPINSVRAGTAAPRVPTGLVPEPRMSTSTV
PSKAPTSTVPTVRSHTPSGETAGAPGPTISTRDSLPEPNPSSSGWESELELSKPGCLASR
VESEPFSGCSADLALSYSKSLDAGPDNAPEENEYQSVDSIRIQVTQDPSVDLLEGNPGPH
ATPEPLEEEDYIQVSTWAPWLRAAATGVFLALFLTVVYRRRLLQ
Download sequence
Identical sequences M3YBC3
ENSMPUP00000008630 XP_004772901.1.14098 XP_004772902.1.14098 XP_012901490.1.14098 ENSMPUP00000008630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]